PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc003377.1_g00006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family Nin-like
Protein Properties Length: 307aa    MW: 34094.9 Da    PI: 6.4189
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc003377.1_g00006.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK76.72.7e-2494142452
                   RWP-RK   4 eisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                              ++s e++s+yF++p++ AA +Lg++ T+LK  CR+ GI+RWP+Rk+ksl
  Itr_sc003377.1_g00006.1  94 TLSKEVISSYFHMPLQHAAEKLGIGETALKEMCRKVGIPRWPYRKLKSL 142
                              7899*******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151918.38377162IPR003035RWP-RK domain
PfamPF020426.4E-2294142IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MAAHSSSSFS NLIDCPVLGY SIWDRHFFTQ ESYFEATPTT EPLNDSLSPT LPTNTEQSCG  60
DNTSVESSEA GEVTIMEDTS HKRGGRGKRP VPSTLSKEVI SSYFHMPLQH AAEKLGIGET  120
ALKEMCRKVG IPRWPYRKLK SLEALMKNVQ DFEENLEDAV TKATVRVLKN RHKLLCDMPG  180
LELDPETLCL RNAYFKLNHM KRKLRKMAMP PSPSISSSCT LFSAAGIDTE DMDIPLIKLL  240
RPRRLKANGA PCHLATPACQ QGAEETDRVT SEGTSLRQIP VDHVYLESAA NLSAMAEVDY  300
LVDSYCP
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA42742142
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66990.11e-25RWP-RK domain-containing protein